CDH13 is localized to the surface of the cell membrane and is anchored by a GPI moiety. The protein lacks the cytoplasmic domain characteristic of other cadherins. This protein acts as a negative regulator of axon growth during neural differentiation. It also protects vascular endothelial cells from apoptosis.

Product Description CDH13 gene encodes a member of the cadherin superfamily. The encoded protein is localized to the surface of the cell membrane and is anchored by a GPI moiety, rather than by a transmembrane domain. The protein lacks the cytoplasmic domain characteristic of other cadherins, and so is not thought to be a cell-cell adhesion glycoprotein. This protein acts as a negative regulator of axon growth during neural differentiation. It also protects vascular endothelial cells from apoptosis due to oxidative stress, and is associated with resistance to atherosclerosis. The gene is hypermethylated in many types of cancer. Full-length extracellular domain of human CDH13 gene (139-693 aa) was constructed with 31 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. Parameter, Testing, and Method CDH13 #5125 Quantity 0.1 mg Volume 0.2 mL Concentration 0.5 mg/mL Purity - SDS PAGE Electrophoresis > 90% Formulation FOrmulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol Form Solution Production Type Recombinant - E. Coli Storage Temperature -20°C Shelf Life Minimum of 6 months from date of receipt Sterilization Method Filtration Cell Assay Pass Sterility - USP modified No Growth Accession Number NP_001248 Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFELSIVVSPILIPENQ RQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTG SVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQN DNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLR YNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKY ELIIEAQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQAT VEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHT NPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPS STATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATD PDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVD NSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAE VCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKIS KINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQV CSCRNSKVDCNAAG