CD14 is a 375 amino acid, phospholipid anchored cell surface protein. This protein is preferentially expressed on monocytes / macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide.

Product Description Human CD14 (monocyte differentiation antigen CD14) is a 375 amino acid, phospholipid anchored cell surface protein. This protein is preferentially expressed on monocytes / macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Full-length extracellular domain of human CD14 gene (20-345 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. Parameter, Testing, and Method CD14 #5089 Quantity 0.1 mg Volume 0.2 mL Concentration 0.5 mg/mL Purity - SDS PAGE Electrophoresis > 90% Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol Form Solution Production Type Recombinant - E. Coli Storage Temperature -20°C Shelf Life Minimum of 6 months from date of receipt Sterilization Method Filtration Cell Assay Pass Sterility - USP modified No Growth Accession Number NP_000582 Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGTTPEPCELDDEDFRC VCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADA DPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKEL TLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQ WLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERG LMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDL SHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN Poduct was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.