CDH18 is expressed specifically in the central nervous system and is putatively involved in synaptic adhesion, axon outgrowth and guidance.

Product Description Human CDH18 gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Human CDH18 is expressed specifically in the central nervous system and is putatively involved in synaptic adhesion, axon outgrowth and guidance. Full-length extracellular domain of human CDH18 gene (54-608 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. Parameter, Testing, and Method CDH18 #5090 Quantity 0.1 mg Volume 0.2 mL Concentration 0.5 mg/mL Purity - SDS PAGE Electrophoresis > 90% Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol Form Solution Production Type Recombinant - E. Coli Storage Temperature -20°C Shelf Life Minimum of 6 months from date of receipt Sterilization Method Filtration Cell Assay Pass Sterility - USP modified No Growth Accession Number NP_004925 Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFGWVWNQFFVLE EHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDT TGDIHSTKSLDREQKTHYVLHAQAIDRRTNKPLEPESEFIIKVQ DINDNAPKFTDGPYIVTVPEMSDMGTSVLQVTATDADDPTYG NSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSV VIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLY VPESAQVGSAVGKIKANDADTGSNADMTYSIINGDGMGIFS ISTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSHLG PFKDATMLKIIVGDVDEPPLFSMPSYLMEVYENAKIGTVVGTVL AQDPDSTNSLVRYFINYNVEDDRFFNIDANTGTIRTTKVLDRE ETPWYNITVTASEIDNPDLLSHVTVGIRVLDVNDNPPELAREYD IIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNF TLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIPSLSSS STLTIRVCACERDGRVRTCHAEAFLSS