CD164 (Sialomucins) belongs to a heterogeneous group of secreted or membrane-associated mucins that appear to play two key but opposing roles in vivo: 1) as cytoprotective or anti-adhesive agents and 2) as adhesion receptors.

Product Description CD164 (Sialomucins) belongs to a heterogeneous group of secreted or membrane-associated mucins that appear to play two key but opposing roles in vivo : 1) as cytoprotective or anti-adhesive agents and 2) as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor. Recombinant CD164 protein may serve as coating matrix protein for studying of hematopoietic stem cell (HSC) functions in vitro . Full-length of human CD164 extracellular domain cDNA (24 – 162 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein. Parameter, Testing, and Method CD164 #5100 Quantity 0.05 mg Volume 0.1 mL Concentration 0.5 mg/mL Purity - SDS PAGE Electrophoresis > 90% Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol Form Solution Production Type Recombinant - E. Coli Storage Temperature -20°C Shelf Life Minimum of 6 months from date of receipt Sterilization Method Filtration Cell Assay Pass Sterility - USP modified No Growth Accession Number NP_006007 Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPI SNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIE CKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQ PSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD