CD270 receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism.

Product Description The protein encoded by human tumor necrosis factor receptor superfamily member 14 ( TNFRSF14, CD270) gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. Recombinant human CD270 extracellular domain cDNA ( 39 – 202 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. Parameter, Testing, and Method CD270 #5127 Quantity 0.1 mg Volume 0.2 mL Concentration 0.5 mg/mL Purity - SDS PAGE Electrophoresis > 90% Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol Form Solution Production Type Recombinant - E. Coli Storage Temperature -20°C Shelf Life Minimum of 6 months from date of receipt Sterilization Method Filtration Cell Assay Pass Sterility - USP modified No Growth Accession Number NP_003811.2 Recombinant Protein Sequence MASMTGGQQMGRGHHHHHHGNLYFQG^GEFLPSCKEDEYP VGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNG LSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIV QDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPG TFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWV